PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 426aa    MW: 44866.4 Da    PI: 7.9608
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003233.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.5e-18345379135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Do003233.1 345 CNHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 379
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577168.08E-14338400No hitNo description
SMARTSM004014.5E-17339393IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.754339375IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.4E-15343377IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.87E-13344401No hitNo description
PROSITE patternPS003440345370IPR000679Zinc finger, GATA-type
PfamPF003201.7E-16345379IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MLHQTLIPSS LPPSVSASDA ATAPPGGSPH CAFPRGSAMP SLAHRHSPLD AGRTDALKSN  60
NCFTPEETAE EAAAVALVEK DGFSVEDLLD LEEFGEPEKD GADNEEALPA PASAAEEKSN  120
EDSKPLSVVR YELPPPPPPE MVDLPAHDVE ELEWVSRIMD DSLCELPPQP QAPTTALVAS  180
LAARPPLAQQ RWTPHVHGGA YRALPSAAGP LRTPTICALS TEARVPVKAK RSKRTRGTGW  240
SLSGASFLSD SASSSSTTTT SSCSSSGSFS SFLLLDPSPF SGLELGEGYY SHFLPAPPSK  300
KSKHGGGKGS KHKPKKPGRK PKHLPPHPSA AGAAASQPAP GDRRCNHCGV QKTPQWRAGP  360
EGAKTLCNAC GVRYKSGRLL PEYRPACSPT FVSSIHSNSH RKVLEMRRKK EDGGMVATAA  420
PAVASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976389.10.0PREDICTED: GATA transcription factor 6-like
TrEMBLK3Y7D50.0K3Y7D5_SETIT; Uncharacterized protein
STRINGSi010126m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.26e-39GATA transcription factor 5